Description

  • Product name

    Recombinant Human GPNMB protein (denatured)
    See all GPNMB proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab171588 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSAKRFHDVLGNERPSAYMREHNQLNGWS SDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAV NLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGT GQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNT ANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDR NSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHT VNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLGPAGDNPLE LSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLI DFVVTCQGSIPTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNG SGTYCVNLTLGDDTSLALTSTLISVP
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      22 to 474
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human GPNMB protein

Specifications

Our Abpromise guarantee covers the use of ab171588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Glycoprotein (transmembrane) nmb
    • Glycoprotein nmb
    • Glycoprotein nmb like protein
    • Gpnmb
    • GPNMB_HUMAN
    • HGFIN
    • NMB
    • Osteoactivin
    • Transmembrane glycoprotein
    • Transmembrane glycoprotein HGFIN
    • Transmembrane glycoprotein NMB
    see all
  • Function

    Could be a melanogenic enzyme.
  • Tissue specificity

    Not restricted to the melanocytic lineage.
  • Sequence similarities

    Belongs to the PMEL/NMB family.
    Contains 1 PKD domain.
  • Developmental stage

    Expression in poorly metastatic melanoma cell lines; no expression in highly metastatic melanoma cell lines.
  • Cellular localization

    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171588 at 3µg.

References

ab171588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up