Overview

  • Product name
    Recombinant Human GPR172B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSY LSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWH HVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLG QGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWAL TALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEA LPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSV QSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGM LFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLL HGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
    • Amino acids
      1 to 448
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10060
    • G protein coupled receptor 172B
    • GPCR
    • GPCR42
    • hRFT1
    • member 1
    • OTTHUMP00000125300
    • PAR2
    • PERV-A receptor 2
    • PERVA receptor 2
    • Porcine endogenous retrovirus A receptor 2
    • Protein GPR172B
    • Putative G protein coupled receptor GPCR42
    • riboflavin transporter
    • Riboflavin transporter 1
    • S52A1_HUMAN
    • SLC52A1
    • Solute carrier family 52
    • Solute carrier family 52, riboflavin transporter, member 1
    see all
  • Function
    Riboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
  • Tissue specificity
    Widely expressed. Highly expressed in the testis, placenta and small intestine. Expressed at lower level in other tissues.
  • Involvement in disease
    Riboflavin deficiency
  • Sequence similarities
    Belongs to the riboflavin transporter family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162951 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up