Overview

  • Product name

    Recombinant Human GPR182 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQS TKRV
    • Amino acids

      1 to 54
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Adrenomedullin Receptor L1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 7TMR
    • ADMR
    • Adrenomedullin L1 receptor
    • Adrenomedullin receptor
    • AM R
    • AM-R
    • AMR
    • G protein coupled receptor 182
    • g protein-coupled receptor g10d
    • G-protein coupled receptor 182
    • G10D
    • Gamrh
    • GP182_HUMAN
    • GPR 182
    • GPR182
    • hAMR
    • hrhAMR
    • MGC34399
    • rAMR
    see all
  • Function

    Orphan receptor.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab161412 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up