Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLT VAALGLAGNGLVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAA GALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGP RPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLT QTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVV ALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCS APTETHSLSWDN
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 362

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C C chemokine receptor type 10
    • C-C chemokine receptor type 10
    • C-C CKR-10
    • CC chemokine receptor 10
    • CC CKR 10
    • CC-CKR-10
    • CCR-10
    • CCR10
    • CCR10_HUMAN
    • Chemokine (C C motif) receptor 10
    • G protein coupled receptor 2
    • G-protein coupled receptor 2
    • GPR2
    see all
  • Function
    Receptor for chemokines SCYA27 and SCYA28. Subsequently transduces a signal by increasing the intracellular calcium ions level and stimulates chemotaxis in a pre-B cell line.
  • Tissue specificity
    Expressed at high levels in adult testis, small intestine, fetal lung, fetal kidney. Weaker expression was observed in many other adult tissues including spleen, thymus, lymph node, Peyer patches, colon, heart, ovary, peripheral blood lymphocytes, thyroid and spinal cord. Also expressed by melanocytes, dermal fibroblasts, dermal microvascular endothelial cells. Also detected in T-cells and in skin-derived Langerhans cells.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131829 stained with Coomassie Blue.

References

ab131829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up