Overview

  • Product name

    Recombinant Human GPR56 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP TPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGR LHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNIS LPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRP SAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLH IHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQ DKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHK HYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLL LAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNL YRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVH RTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLR PHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQ GFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI
    • Amino acids

      1 to 693
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 7 transmembrane protein with no EGF like N terminal domains 1
    • BFPP
    • DKFZp781L1398
    • EGF TM7 like
    • G protein coupled receptor 56
    • G-protein coupled receptor 56
    • GPR 56
    • Gpr56
    • GPR56_HUMAN
    • Polymicrogyria bilateral frontoparietal
    • Protein TM7XN1
    • TM7LN4
    • TM7XN1
    • TM7XN1 protein
    see all
  • Function

    Could be involved in cell-cell interactions.
  • Tissue specificity

    Widely distributed with highest levels found in thyroid gland, brain and heart. Expressed in a great number of tumor cells.
  • Involvement in disease

    Polymicrogyria, bilateral frontoparietal (BFPP) [MIM:606854]: A malformation of the cortex in which the brain surface is irregular and characterized by an excessive number of small gyri with abnormal lamination, most severe in the frontoparietal regions. BFPP clinical manifestations include developmental and psychomotor delay, cerebellar and pyramidal signs, truncal ataxia, seizures, hyperreflexia. Polymicrogyria is a heterogeneous disorder, considered to be the result of postmigratory abnormal cortical organization. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 1 GPS domain.
  • Post-translational
    modifications

    The endogenous protein is proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab160418 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up