Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRS FPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLA
    • Amino acids
      31 to 130
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 7 transmembrane protein with no EGF like N terminal domains 1
    • BFPP
    • DKFZp781L1398
    • EGF TM7 like
    • G protein coupled receptor 56
    • G-protein coupled receptor 56
    • GPR 56
    • Gpr56
    • GPR56_HUMAN
    • Polymicrogyria bilateral frontoparietal
    • Protein TM7XN1
    • TM7LN4
    • TM7XN1
    • TM7XN1 protein
    see all
  • Function
    Could be involved in cell-cell interactions.
  • Tissue specificity
    Widely distributed with highest levels found in thyroid gland, brain and heart. Expressed in a great number of tumor cells.
  • Involvement in disease
    Polymicrogyria, bilateral frontoparietal (BFPP) [MIM:606854]: A malformation of the cortex in which the brain surface is irregular and characterized by an excessive number of small gyri with abnormal lamination, most severe in the frontoparietal regions. BFPP clinical manifestations include developmental and psychomotor delay, cerebellar and pyramidal signs, truncal ataxia, seizures, hyperreflexia. Polymicrogyria is a heterogeneous disorder, considered to be the result of postmigratory abnormal cortical organization. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 1 GPS domain.
  • Post-translational
    modifications
    The endogenous protein is proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160419 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up