Overview

  • Product name

    Recombinant Human GPRC5C protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIIL PRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD
    • Amino acids

      387 to 486
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G protein coupled receptor family C group 5 member C
    • G-protein coupled receptor family C group 5 member C
    • GPC5C_HUMAN
    • GPCR5C
    • Gprc5c
    • MGC131820
    • Orphan G protein coupled receptor
    • RAIG-3
    • RAIG3
    • Retinoic acid responsive gene protein
    • Retinoic acid-induced gene 3 protein
    see all
  • Function

    This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
  • Tissue specificity

    Expression is highest in the periphery, particularly in the stomach, but also in the kidney, liver, pancreas, and prostate. In brain, levels of expression are generally lower than in the periphery, with the exception of cerebellum, spinal cord, and dorsal root ganglia (DRG).
  • Sequence similarities

    Belongs to the G-protein coupled receptor 3 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle membrane. Localized in the plasma membrane and perinuclear vesicles.
  • Information by UniProt

Images

  • ab163266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up