Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQ SRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSS RIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQG AGGPPEPQQQCQPGAS
    • Amino acids

      1 to 166
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Activator of G-protein signaling 3
    • AGS3
    • AGS3 homolog
    • C10a
    • G protein signaling modulator 1 (AGS3 like, C. elegans)
    • G-protein-signaling modulator 1
    • GPSM1
    • GPSM1_HUMAN
    see all
  • Function

    Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from G protein-coupled receptors. Controls spindle orientation and asymmetric cell fate of cerebral cortical progenitors. May also be involved in macroautophagy in intestinal cells. May play a role in drug addiction.
  • Tissue specificity

    Expressed in intestinal cells.
  • Sequence similarities

    Belongs to the GPSM family.
    Contains 4 GoLoco domains.
    Contains 9 TPR repeats.
  • Domain

    The GoLoco domains mediate interaction with G(i/o) alpha (By similarity). The GoLoco domains are essential for the GDI activity toward G(i/o) alpha.
  • Post-translational
    modifications

    Phosphorylation regulates interaction with G(i/o) alpha.
  • Cellular localization

    Cytoplasm > cytosol. Endoplasmic reticulum membrane. Golgi apparatus membrane. Cell membrane.
  • Information by UniProt

Images

  • ab161892 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up