Description

  • Product name

    Recombinant Human Grancalcin protein
  • Purity

    > 95 % SDS-PAGE.
    ab103054 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAYPGYGGGFGNFSIQVPGMQMGQPVPETG PAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQS GINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMT VDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 217
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • GCA
    • GCL
  • Relevance

    Grancalcin is a calcium binding protein abundant in neutrophils and macrophages. It belongs to the penta EF hand subfamily of proteins which includes sorcin, calpain, and ALG2. Grancalcin localization is dependent upon calcium and magnesium. In the absence of divalent cation, grancalcin localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions, suggesting a role for grancalcin in granule membrane fusion and degranulation.
  • Cellular localization

    50% cytoplasmic, the remainder being attached to the membranes and granules.

Images

  • 15% SDS-PAGE analysis of 3µg ab103054.

References

ab103054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up