Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKT SFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH
    • Amino acids
      148 to 247
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C11
    • Cathepsin G like 1
    • Cathepsin G-like 1
    • CCPI
    • CGL 1
    • CGL1
    • CSP B
    • CSPB
    • CTLA-1
    • CTLA1
    • CTSGL1
    • Cytotoxic serine protease B
    • Cytotoxic T lymphocyte associated serine esterase 1
    • Cytotoxic T lymphocyte proteinase 2
    • Cytotoxic T-lymphocyte proteinase 2
    • Fragmentin 2
    • Fragmentin-2
    • GRAB_HUMAN
    • Granzyme 2
    • Granzyme B
    • Granzyme B (granzyme 2, cytotoxic T lymphocyte associated serine esterase 1)
    • Granzyme-2
    • GranzymeB
    • GRB
    • Gzmb
    • Hlp
    • Human lymphocyte protein
    • Lymphocyte protease
    • Protease, serine, B
    • SECT
    • T cell serine protease 1-3E
    • T-cell serine protease 1-3E
    see all
  • Function
    This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.
  • Sequence similarities
    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Cytoplasmic granule. Cytoplasmic granules of cytolytic T-lymphocytes and natural killer cells.
  • Information by UniProt

Images

  • ab158623 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up