Description

  • Product name

    Recombinant Human Granzyme B protein (denatured)
    See all Granzyme B proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMIIGGHEAKPHSRPYMAYLMIWDQKSLKRC GGFLIQDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPA YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQ TAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSF KGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      21 to 247
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 247. The signal peptide and propeptide are not included (NP_004122).
  • Description

    Recombinant Human Granzyme B protein

Specifications

Our Abpromise guarantee covers the use of ab202180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.24% Tris

General Info

  • Alternative names

    • C11
    • Cathepsin G like 1
    • Cathepsin G-like 1
    • CCPI
    • CGL 1
    • CGL1
    • CSP B
    • CSPB
    • CTLA 1
    • CTLA-1
    • CTLA1
    • CTSGL1
    • Cytotoxic serine protease B
    • Cytotoxic T lymphocyte associated serine esterase 1
    • Cytotoxic T lymphocyte proteinase 2
    • Cytotoxic T-lymphocyte proteinase 2
    • Fragmentin 2
    • Fragmentin-2
    • GRAB_HUMAN
    • Granzyme 2
    • Granzyme B
    • Granzyme B (granzyme 2, cytotoxic T lymphocyte associated serine esterase 1)
    • Granzyme-2
    • GranzymeB
    • GRB
    • Gzmb
    • Hlp
    • Human lymphocyte protein
    • Lymphocyte protease
    • Protease, serine, B
    • SECT
    • T cell serine protease 1 3E
    • T cell serine protease 1-3E
    • T-cell serine protease 1-3E
    see all
  • Function

    This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.
  • Sequence similarities

    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Cytoplasmic granule. Cytoplasmic granules of cytolytic T-lymphocytes and natural killer cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202180 (3 µg).

References

ab202180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up