Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQ SPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAA KLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVL SRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHA IVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
    • Molecular weight
      26 kDa
    • Amino acids
      27 to 264

Specifications

Our Abpromise guarantee covers the use of ab157277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific Activity: ~29U/µg protein. One unit is defined as the amount of enzyme that hydrolyzes 1nmol Z-Lys-SBzl per min. at 25°C in 0.05M TRIS, pH 8.0, containing 0.15M NaCl, 0.01% Triton X-100 and 0.3mM DTNB.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 98 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes
    Dilute solutions (e. g. 1-1000ng/ml) should be used within 24 hours.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 87% PBS, 10% Sucrose, 2.9% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Fragmentin 3
    • Fragmentin-3
    • Fragmentin3
    • GRAK_HUMAN
    • Granzyme 3
    • Granzyme K
    • granzyme K (granzyme 3; tryptase II)
    • granzyme K (serine protease, granzyme 3; tryptase II)
    • Granzyme K precursor
    • Granzyme-3
    • Granzyme3
    • GranzymeK
    • GZMK
    • NK TRYP 2
    • NK TRYP2
    • NK tryptase 2
    • NK-TRYP-2
    • NK-tryptase-2
    • NKTRYP2
    • Serine protease granzyme 3
    • TRYP 2
    • TRYP2
    • Tryptase II
    • TryptaseII
    see all
  • Tissue specificity
    Expressed in lung, spleen, thymus and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. Cytoplasmic granule.
  • Information by UniProt

References

ab157277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up