Description

  • Product name

    Recombinant Human Granzyme K protein (His tag)
    See all Granzyme K proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab219487 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFT KGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQ TAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTV TVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGV FHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTNHHHHH
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      27 to 264
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 27 to 264. The signal peptide and propeptide are not included (NP_002095).

Specifications

Our Abpromise guarantee covers the use of ab219487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 79% PBS, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Fragmentin 3
    • Fragmentin-3
    • Fragmentin3
    • GRAK_HUMAN
    • Granzyme 3
    • Granzyme K
    • granzyme K (granzyme 3; tryptase II)
    • granzyme K (serine protease, granzyme 3; tryptase II)
    • Granzyme K precursor
    • Granzyme-3
    • Granzyme3
    • GranzymeK
    • GZMK
    • NK TRYP 2
    • NK TRYP2
    • NK tryptase 2
    • NK-TRYP-2
    • NK-tryptase-2
    • NKTRYP2
    • Serine protease granzyme 3
    • TRYP 2
    • TRYP2
    • Tryptase II
    • TryptaseII
    see all
  • Tissue specificity

    Expressed in lung, spleen, thymus and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Cytoplasmic granule.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219487.

    Molecular Weight: 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab219487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up