Overview

  • Product name

    Recombinant Human GRAP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPK NYIRVKPHPWYSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVN YGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTIAKKRQIFLRD EEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRS CGRVGFFPRSYVQPVHL
    • Molecular weight

      50 kDa including tags
    • Amino acids

      1 to 217

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Grap
    • GRAP_HUMAN
    • GRB2 related adaptor protein
    • GRB2-related adapter protein
    • Growth factor receptor bound protein 2 related adaptor protein
    • MGC64880
    • OTTHUMP00000065766
    see all
  • Function

    Couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway.
  • Sequence similarities

    Belongs to the GRB2/sem-5/DRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131803 stained with Coomassie Blue.

References

ab131803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up