Description

  • Product name

    Recombinant human Gremlin 1 protein (Fc Chimera Active)
    See all Gremlin 1 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.  Immobilized Human BMP-2, Tag Free (0.2 μg/well) can bind ab220453 with a linear range of 0.0008-0.08 μg/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVL ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNS FYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVK QCRCISIDLDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      25 to 184
    • Additional sequence information

      Mature form with Fc fragment of human IgG1 at the C-terminus. NP_037504.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.02% EDTA, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BMP antagonist 1
    • Cell proliferation inducing gene 2 protein
    • Cell proliferation-inducing gene 2 protein
    • CKTSF1B1
    • colorectal adenoma and carcinoma 1
    • Cysteine knot superfamily 1
    • Cysteine knot superfamily 1, BMP antagonist 1
    • Cysteine knot superfamily BMP antagonist 1
    • DAN domain family member 2
    • DAND2
    • Down regulated in Mos-transformed cells protein
    • Down-regulated in Mos-transformed cells protein
    • DRM
    • grem1
    • GREM1_HUMAN
    • GREMLIN
    • Gremlin 1 homolog, cysteine knot superfamily
    • Gremlin 1 like protein
    • Gremlin 1, cysteine knot superfamily, homolog
    • Gremlin-1
    • Gremlin1
    • IHG-2
    • IHG2
    • Increased in high glucose 2
    • Increased in high glucose protein 2
    • PIG2
    • Proliferation inducing gene 2
    • proliferation inducing gene 2 protein
    see all
  • Function

    Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner. Acts as inhibitor of monocyte chemotaxis.
  • Tissue specificity

    Highly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEMFs, but also at very high levels in epithelial cells (predominantly colonocytes), with expression extending most of the way up the sides of the crypt. Weakly expressed in brain, ovary, prostate, pancreas and skeletal muscle. In brain found in the region localized around the internal capsule in the large subcortical nuclei, including caudate, putamen, substantia nigra, thalamus and subthalamus. Predominantly expressed in normal cells including neurons, astrocytes and fibroblasts.
  • Involvement in disease

    Polyposis syndrome, mixed hereditary 1
  • Sequence similarities

    Belongs to the DAN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab220453 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates as 48-60 kDa.

  • Immobilized Human BMP-2, Tag Free at 2μg/mL (100 μL/well) can bind ab220453 with a linear range of 0.0008-0.08 μg/mL.

References

ab220453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up