Description

  • Product name

    Recombinant Human GRIK2/GluK2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPM GAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLS LGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLK IRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTE YYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER LQAPPKPDSGLLDGFMTMEFHSCCPGWSAMARSHLTAASASWVQAILLPQ PPE
    • Amino acids

      1 to 353
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GRIK2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA487F5.1
    • EAA4
    • Excitatory amino acid receptor 4
    • GLR 6
    • GLR6
    • GluK2
    • GLUK6
    • GLUR 6
    • GluR-6
    • GluR6
    • Glutamate receptor
    • Glutamate receptor 6
    • glutamate receptor form A
    • glutamate receptor form B
    • glutamate receptor form C
    • glutamate receptor form D
    • glutamate receptor form E
    • Glutamate receptor ionotropic kainate 2
    • GRIK 2
    • GRIK2
    • GRIK2 protein
    • GRIK2_HUMAN
    • ionotropic kainate 2
    • MRT6
    see all
  • Function

    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2.
  • Tissue specificity

    Expression is higher in cerebellum than in cerebral cortex.
  • Involvement in disease

    Defects in GRIK2 are the cause of mental retardation autosomal recessive type 6 (MRT6) [MIM:611092]. It is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic mental retardation. MRT6 patients display mild to severe mental retardation and psychomotor development delay in early childhood. Patients do not have neurologic problems, congenital malformations, or facial dysmorphism. Body height, weight, and head circumference are normal.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK2 subfamily.
  • Post-translational
    modifications

    Sumoylation mediates kainate receptor-mediated endocytosis and regulates synaptic transmission. Sumoylation is enhanced by PIAS3 and desumoylated by SENP1.
    Ubiquitinated. Ubiquitination regulates the GRIK2 levels at the synapse by leading kainate receptor degradation through proteasome.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab158581 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up