Overview

  • Product name
    Recombinant Human GRIM19 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSI MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKD VPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
    • Amino acids
      1 to 144
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2700054G14Rik
    • AU022060
    • B16.6
    • CDA016
    • Cell death regulatory protein
    • Cell death regulatory protein GRIM-19
    • CGI-39
    • CGI39 protein
    • CI-B16.6
    • Complex I-B16.6
    • FLJ58045
    • FLJ59191
    • Gene associated with retinoic and IFN-induced mortality 19 protein
    • Gene associated with retinoic and interferon-induced mortality 19 protein
    • Gene associated with retinoic interferon induced mortality 19 protein
    • GRIM-19
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
    • NADH ubiquinone oxidoreductase B16.6 subunit
    • NADH-ubiquinone oxidoreductase B16.6 subunit
    • NDUAD_HUMAN
    • NDUFA13
    • RGD1565358
    see all
  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.
  • Tissue specificity
    Widely expressed, with highest expression in heart, skeletal muscle, liver, kidney and placenta. In intestinal mucosa, down-regulated in areas involved in Crohn disease and ulcerative colitis.
  • Involvement in disease
    Defects in NDUFA13 may be a cause of susceptibility to Hurthle cell thyroid carcinoma (HCTC) [MIM:607464]. Hurthle cell thyroid carcinoma accounts for approximately 3% of all thyroid cancers. Although they are classified as variants of follicular neoplasms, they are more often multifocal and somewhat more aggressive and are less likely to take up iodine than are other follicular neoplasms.
  • Sequence similarities
    Belongs to the complex I NDUFA13 subunit family.
  • Developmental stage
    Expressed in numerous fetal tissues.
  • Cellular localization
    Mitochondrion inner membrane. Nucleus. May be translocated into the nucleus upon IFN/RA treatment.
  • Information by UniProt

Images

  • ab162405 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up