Overview

  • Product name

    Recombinant Human GRLF1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
    • Molecular weight

      30 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab132572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARHGAP35
    • GAP associated protein p190
    • Glucocorticoid receptor DNA binding factor 1
    • Glucocorticoid receptor DNA-binding factor 1
    • Glucocorticoid receptor repression factor 1
    • GRF 1
    • GRF-1
    • GRF1
    • GRLF 1
    • GRLF1
    • GRLF1_HUMAN
    • KIAA1722
    • MGC10745
    • p190 A
    • p190-A
    • P190A
    • P190A, rat, homolog of
    • p190ARhoGAP
    • p190RhoGAP
    • Rho GAP p190A
    • Rho GTPase-activating protein 35
    see all
  • Function

    Represses transcription of the glucocorticoid receptor by binding to the cis-acting regulatory sequence 5'-GAGAAAAGAAACTGGAGAAACTC-3'. May participate in the regulation of retinal development and degeneration. May transduce signals from p21-ras to the nucleus, acting via the ras GTPase-activating protein (GAP). May also act as a tumor suppressor.
  • Sequence similarities

    Contains 4 FF domains.
    Contains 1 Rho-GAP domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132572 stained with Coomassie Blue.

References

ab132572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up