Recombinant Human GRP protein (BSA and azide free) (ab173063)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRP GKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNS CISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHR IQTLSAIDTIKINGDLQITKLGLEHHHHHH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      2 to 172
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.58% Sodium chloride

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Galectin-related protein
    • GRP
    • HSPC159
    • lectin, galactoside-binding-like
    • LEGL_HUMAN
    • LGALSL
    • MGC188016
    • MGC33751
    • MGC71953
    • RGD1307414
    see all
  • Function
    Does not bind lactose, and may not bind carbohydrates.
  • Sequence similarities
    Contains 1 galectin domain.
  • Information by UniProt

References

ab173063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up