Overview

  • Product name
    Recombinant Human GSDMB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCR HYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQILDNVDSTGELIVRL PKEITISGSFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSIN TRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIP PNRVLSYRVKQLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMK EKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISRE LHMEDSDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEAL EKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILL ELAEGPTSVSS
    • Amino acids
      1 to 411
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 123
    • 156
    • Gasdermin B
    • Gasdermin like protein
    • Gasdermin-B
    • Gasdermin-like protein
    • GSDMB
    • GSDMB_HUMAN
    • GSDML
    • PP4052
    • PRO2521
    see all
  • Function
    The N-terminal moiety promotes pyroptosis. May be acting by homooligomerizing within the membrane and forming pores (PubMed:27281216). The physiological relevance of this observation is unknown.
  • Tissue specificity
    In the gastrointestinal tract, expressed in proliferating cells, including in the basal cell layer of esophagus and in isthmus/neck of stomach.
  • Sequence similarities
    Belongs to the gasdermin family.
  • Domain
    Intramolecular interactions between N- and C-terminal domains may be important for autoinhibition in the absence of activation signal. The intrinsic pyroptosis-inducing activity is carried by the N-terminal domain.
  • Cellular localization
    Cytoplasm. Cytoplasm, cytosol. Cell membrane. Vesicular localization in the apical region of gastric chief cells and colonic surface mucous cells, and the basal region of neuroendocrine cells.
  • Information by UniProt

Images

  • ab163263 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up