Description

  • Product name

    Recombinant Human GSKIP protein
  • Purity

    > 95 % SDS-PAGE.
    ab105621 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMETDCNPMELSSMSGFEEGSELNGFEGTDM KDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLEL TEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRL EALKRDGQS
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      1 to 139
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as HSPC210.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • C14ORF129
    • Chromosome 14 open reading frame 129
    • GSK3-beta interaction protein
    • GSK3beta interaction protein
    • GSKIP
    • GSKIP_HUMAN
    • MGC4945
    • UPF0279
    see all
  • Tissue specificity

    Detected in heart, brain, placenta, liver, skeletal muscle, kidney, testis, lung and pancreas.
  • Sequence similarities

    Belongs to the UPF0279 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab105621 (3µg)

References

ab105621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up