Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLM FQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIAD LGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGN KLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPG SPRKPPMDEKSLEEARKIFRF
    • Molecular weight
      26 kDa
    • Amino acids
      1 to 222

Specifications

Our Abpromise guarantee covers the use of ab167981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is 5-8 units/mg, and is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Glutathione S alkyltransferase A1
    • Glutathione S aryltransferase A1
    • Glutathione S transferase 2
    • Glutathione S transferase A1
    • Glutathione S transferase alpha 1
    • Glutathione S transferase Ha subunit 1
    • Glutathione S-transferase A1
    • GST class-alpha member 1
    • GST epsilon
    • GST HA subunit 1
    • GST, class alpha, 1
    • GST-epsilon
    • GST2
    • GSTA1
    • GSTA1 1
    • GSTA1-1
    • GSTA1_HUMAN
    • GTH1
    • HA subunit 1
    • MGC131939
    • OTTHUMP00000016611
    • S (hydroxyalkyl)glutathione lyase A1
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Tissue specificity
    Liver.
  • Sequence similarities
    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Domain
    The C-terminal domain may form a component of the hydrophobic substrate-binding site, but in contrast appears not to be directly involved in GSH binding and is not absolutely essential for catalytic activity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of ab167981 at 3 µg.

References

ab167981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up