Description

  • Product name

    Recombinant Human GSTA3 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSL MFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMA DLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVG NKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      1 to 222

Specifications

Our Abpromise guarantee covers the use of ab116930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Glutathione S alkyltransferase A3
    • Glutathione S aralkyltransferase A3
    • Glutathione S aryltransferase A3
    • Glutathione S transferase A3
    • Glutathione S transferase A3 3
    • glutathione S transferase A3 subunit
    • Glutathione S transferase alpha 3
    • Glutathione S transferase alpha type (Ya)
    • glutathione S transferase Yc 1
    • glutathione S transferase Yc1 subunit
    • Glutathione S-transferase A3
    • Glutathione S-transferase A3-3
    • Glutathione S-transferase Ya3
    • Glutathione S-transferase Yc
    • glutathione transferase A3 subunit
    • Glutathione transferase alpha 3
    • GST 2 2
    • GST AA
    • GST class alpha
    • GST class alpha member 3
    • GST class-alpha member 3
    • GST Yc1
    • GSTA 3
    • Gsta3
    • GSTA3 3
    • GSTA3-3
    • GSTA3_HUMAN
    • Gstyc
    • GTA 3
    • GTA3
    • MGC22232
    • S (hydroxyalkyl)glutathione lyase A3
    • Yc1
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively.
  • Sequence similarities

    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116930 at approximately 50.53 kDa.

References

ab116930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up