Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMAARPKLHYPNGRGRMESVRWVLAAA GVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIA DKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQ KAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILS AFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
    • Molecular weight

      28 kDa including tags
    • Amino acids

      1 to 222
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001503.

Specifications

Our Abpromise guarantee covers the use of ab206797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 4,000 pmol/min/ug, and is defined as the amount of enzyme that conjugate 1.0 u mole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25 degC.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab206797 was expressed in E.coli and purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DKFZp686D21185
    • Glutathione S alkyltransferase A4
    • Glutathione S aralkyltransferase A4
    • Glutathione S aryltransferase A4
    • Glutathione S transferase A4
    • Glutathione S transferase A4 4
    • Glutathione S transferase alpha 4
    • Glutathione S-transferase A4
    • Glutathione S-transferase A4-4
    • Glutathione transferase A4 4
    • GST class alpha member 4
    • GST class-alpha member 4
    • GSTA4
    • GSTA4 4
    • GSTA4_HUMAN
    • GTA4
    • OTTHUMP00000016624
    • OTTHUMP00000016625
    • S (hydroxyalkyl)glutathione lyase A4
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
  • Tissue specificity

    Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
  • Sequence similarities

    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab206797 (3 µg).

References

ab206797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up