Description

  • Product name

    Recombinant Human GSTK1 protein
    See all GSTK1 proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHASGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRP SLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVM LEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAA AEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVD GQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      2 to 226
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab206453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Glutathione S Transferase kappa 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names

    • EC 2.5.1.18
    • Glutathione S Transferase kappa 1
    • Glutathione S transferase subunit 13
    • Glutathione S-transferase k1
    • Glutathione S-transferase kappa 1
    • Glutathione S-transferase subunit 13
    • Glutathione S-transferase subunit 13 homolog
    • GST
    • GST 13 13
    • GST 13-13
    • GST class kappa
    • GST class-kappa
    • GST13
    • GST13-13
    • Gstk1
    • GSTK1 1
    • GSTK1-1
    • GSTK1_HUMAN
    • hGSTK1
    see all
  • Function

    Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the GST superfamily. Kappa family.
  • Cellular localization

    Peroxisome.
  • Information by UniProt

Images

  • 14 % SDS-PAGE analysis of ab206453.

    Lane 1: Reduced and boiled sample, 2.5 μg/lane
    Lane 2: Non-reduced and non-boiled sample, 2.5 μg/lane

References

ab206453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up