Description

  • Product name

    Recombinant Human GSTM2 protein
    See all GSTM2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab99435 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPMTLGYWNIRGLAHSIRLLLEYTDSSYEE KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYI ARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQA LPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
    • Predicted molecular weight

      28 kDa
    • Amino acids

      1 to 218
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Glutathione S alkyltransferase M2
    • Glutathione S aralkyltransferase M2
    • Glutathione S aryltransferase M2
    • Glutathione S transferase 4
    • Glutathione S transferase M1
    • Glutathione S transferase M2 (muscle)
    • Glutathione S transferase Mu 2
    • Glutathione S transferase Mu 2 (muscle)
    • Glutathione S-transferase Mu 2
    • GST class mu 2
    • GST class-mu 2
    • GST muscle
    • GST4
    • GSTM
    • GSTM2
    • GSTM2-2
    • GSTM2_HUMAN
    • GTHMUS
    • MGC117303
    • S (hydroxyalkyl)glutathione lyase M2
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Tissue specificity

    Muscle.
  • Sequence similarities

    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99435 at approximately 27.9kDa (3µg).

References

ab99435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up