Description

  • Product name

    Recombinant human GSTM5 protein
    See all GSTM5 proteins and peptides
  • Biological activity

    Specific activity is > 90,000 pmol/min/µg, and is defined as the amount of enzyme that conjugate 1.0 u mole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25 degC.

  • Purity

    > 95 % SDS-PAGE.
    ab207801 was expressed in E.coli and purified by using conventional chromatography techniques
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMPMTLGYWDIRGLAHAIRLLLEYTDS SYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAI LRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPK YLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLD AFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      1 to 218
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000842.

Specifications

Our Abpromise guarantee covers the use of ab206801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Glutathione S alkyltransferase M5
    • Glutathione S aralkyltransferase M5
    • Glutathione S aryltransferase M5
    • Glutathione S transferase M5
    • Glutathione S transferase Mu 5
    • Glutathione S-transferase Mu 5
    • GST class mu 5
    • GST class-mu 5
    • GSTM 5
    • Gstm5
    • GSTM5 5
    • GSTM5-5
    • GSTM5_HUMAN
    • GTM 5
    • GTM5
    • OTTHUMP00000013359
    • OTTHUMP00000013361
    • S (hydroxyalkyl)glutathione lyase M5
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Sequence similarities

    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab206801 (3 µg).

References

ab206801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up