Description

  • Product name

    Recombinant Human GSTZ1 protein
    See all GSTZ1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF QALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVR MISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTA GIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQ VSHPCRQPDTPTELRALEHHHHHH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 216
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Glutathione Transferase zeta 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.79% Tris HCl, 0.02% DTT

General Info

  • Alternative names

    • EC 2.5.1.18
    • EC 5.2.1.2
    • Glutathione S transferase zeta 1
    • Glutathione S-transferase zeta 1
    • Gstz1
    • GSTZ1-1
    • MAAI
    • MAAI_HUMAN
    • Maleylacetoacetate isomerase
    see all
  • Function

    Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.
  • Tissue specificity

    Mostly expressed in liver followed by kidney, skeletal muscle and brain. Also expressed in melanocytes, synovium, placenta, breast and fetal liver and heart.
  • Pathway

    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 5/6.
  • Sequence similarities

    Belongs to the GST superfamily. Zeta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172170 under non reduced (lane 1) and reduced (lane 2) conditions.

References

ab172170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up