Description

  • Product name

    Recombinant Human GTF2A1 protein
    See all GTF2A1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab174399 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMANSANTNTVPKLYRSVIEDVINDVRD IFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQ QQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQ HMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQ PQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQIL FTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVD
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      1 to 274
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Squence relates to the transcription initiation factor IIA alpha chain. NCBI Accession No. NP_056943.

Specifications

Our Abpromise guarantee covers the use of ab174399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • General transcription factor IIA 1 19/37kDa
    • General transcription factor IIA subunit 1
    • General transcription factor IIA1
    • Glucose regulated protein 58kD pseudogene
    • gtf2a1
    • TF2A1
    • TF2AA_HUMAN
    • TFIIA 42
    • TFIIA alpha p55
    • TFIIA alpha p55, isoform 1
    • TFIIA p19 subunit
    • TFIIA p35 subunit
    • TFIIA-42
    • TFIIAL
    • Transcription initiation factor IIA beta chain
    • Transcription initiation factor IIA subunit 1
    • Transcription initiation factor TFIIA 42 kDa subunit
    see all
  • Function

    TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
  • Sequence similarities

    Belongs to the TFIIA subunit 1 family.
  • Post-translational
    modifications

    The alpha and beta subunits are postranslationally produced from the precursor form by TASP1. The cleavage promotes proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174399 (3μg).

References

ab174399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up