Description

  • Product name

    Recombinant Human GTF2IRD2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAQVAVSTLPVEEESSSETRMVVTFLVSALESMCKELAKSKAEVACIAVY ETDVFVVGTERGCAFVNARTDFQKDFAKYCVAEGLCEVKPPCPVNGMQVH SGETEILRKAVEDYFCFCYGKALGTTVMVPVPYEKMLRDQSAVVVQGLPE GVAFQHPENYDLATLKWILENKAGISFIINRPFLGPESQLGGPGMVTDAE RSIVSPSESCGPINVKTEPMEDSGISLKAEAVSVKKESEDPNYYQYNMQG SHPSSTSNEVIEMELPMEDSTPLVPSEEPNEDPEAEVKIEGNTNSSSVTN SAAGVEDLNIVQVTVPDNEKERLSSIEKIKQLREQVNDLFSRKFGEAIGV DFPVKVPYRKITFNPGCVVIDGMPPGVVFKAPGYLEISSMRRILEAAEFI KFTVIRPLPGLELSNGLLEAGAGGLLEAGSLRPAWATWQDPISTKNLKIS WKQWLTPVAPATWQAEAGGSLELRSLRQQRTIIAILHSSLGDRTRPCL
    • Amino acids

      1 to 498
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ21423
    • FLJ37938
    • FP630
    • general transcription factor II i repeat domain 2 alpha
    • general transcription factor II I repeat domain-containing protein 2A
    • GTF2I repeat domain containing 2
    • GTF2I repeat domain containing protein 2A
    • GTF2IRD2 alpha
    • GTF2IRD2A
    • MGC75203
    • transcription factor GTF2IRD2
    • Transcription factor GTF2IRD2 alpha
    see all
  • Relevance

    GTF2IRD2 N-terminal half contains a leucine zipper motif, followed by 2 helix-loop-helix motifs (I repeats) that share homology with the TFII-I family of transcription factors. The C-terminal half of GTF2IRD2A contains a CHARLIE8 transposable element-like sequence, including 3 transposase-related domains that may be functional, and a BED zinc finger DNA-binding motif. It is inferred to be a transcription factor based on the presence of GTF2I-like repeats (containing helix-loop-helix motifs), also found in other proteins such as GTF2IRD1 and GTF2I. GTF2IRD2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. There are six different isoforms, generated by alternative splicing.
  • Cellular localization

    Nuclear

Images

  • ab164511 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up