Overview

  • Product name
    Recombinant Human GTF3C4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLR CFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
    • Amino acids
      723 to 822
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.3.1.48
    • FLJ21002
    • General transcription factor 3C 4
    • General transcription factor 3C polypeptide 4
    • General transcription factor IIIC, polypeptide 4, 90kDa
    • GTF3C4
    • KAT12
    • MGC138450
    • OTTHUMP00000022434
    • TF3C delta
    • TF3C-delta
    • TF3C4_HUMAN
    • TFIII90
    • TFIIIC 90 kDa subunit
    • TFiiiC2 90
    • TFIIIC290
    • TFIIIC90
    • TFIIICdelta
    • Transcription factor IIIC 90 kDa subunit
    • Transcription factor IIIC subunit delta
    see all
  • Function
    Essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA, tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin. Has histone acetyltransferase activity (HAT) with unique specificity for free and nucleosomal H3. May cooperate with GTF3C5 in facilitating the recruitment of TFIIIB and RNA polymerase through direct interactions with BRF1, POLR3C and POLR3F. May be localized close to the A box.
  • Sequence similarities
    Belongs to the TFIIIC subunit 4 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160431 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up