Overview

  • Product name
    Recombinant Human GTPBP3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVD LAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLAS
    • Amino acids
      244 to 343
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ14700
    • GTP binding protein 3
    • GTP binding protein 3 mitochondrial
    • GTPBG 3
    • GTPBG3
    • GTPBP 3
    • Mitochondrial GTP binding protein
    • Mitochondrial GTP binding protein 1
    • MSS 1
    • MSS1
    • MTGP 1
    • MTGP1
    • THDF 1
    • THDF1
    • tRNA modification GTPase GTPBP3
    • tRNA modification GTPase GTPBP3 mitochondrial
    see all
  • Relevance
    The GTPBP3 is the mitochondrial GTPase evolutionarily conserved from bacteria to mammals. GTPBP3 is ubiquitously expressed in various tissues. GTPBP3 localizes in mitochondrion. The human GTPBP3 is a deafness associated homolog of yeast MSS1. The allelic variants in GTPBP3 could modulate the phenotypic manifestation of human mitochondrial A1555G mutation. GTPBP3 may be involved in the 5 carboxymethylaminomethyl modification (mnm(5)s(2)U34) of the wobble uridine base in mitochondrial tRNAs.
  • Cellular localization
    Mitochondrial

Images

  • ab164646 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up