Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATMPICQDI PEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKH KIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEVFKICYEEDEN ILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFL HVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQ PYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYL SDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKT VDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPL QVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIA LMAVKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEI PGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID
    • Molecular weight

      104 kDa including tags
    • Amino acids

      1 to 690

Specifications

Our Abpromise guarantee covers the use of ab132443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Guanylyl Cyclase alpha 1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GC S alpha 1
    • GC SA3
    • GCS alpha 1
    • GCS alpha 3
    • GCS-alpha-1
    • GCS-alpha-3
    • GCYA3_HUMAN
    • Guanylate cyclase 1 soluble alpha 3
    • Guanylate cyclase soluble subunit alpha 1
    • Guanylate cyclase soluble subunit alpha 3
    • Guanylate cyclase soluble subunit alpha-3
    • Guanylate cyclase, nitric oxide-sensitive, alpha-1 subunit
    • Guc1a1
    • GUC1A3
    • GUCA3
    • GUCSA3
    • Gucy1a1
    • Gucy1a3
    • MYMY6
    • nitric oxide-sensitive Guanylate cyclase, alpha-1 subunit
    • NOGC, alpha-1 subunit
    • Soluble guanylate cyclase large subunit
    see all
  • Sequence similarities

    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132443 stained with Coomassie Blue

References

ab132443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up