Overview

  • Product name

    Recombinant Human GUCY1A2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      CENTNIMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEG LRKQLRCDTHKVLKFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEAS GSENKD
    • Amino acids

      296 to 401
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Guanylyl Cyclase alpha 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GC SA2
    • GCS alpha 2
    • GCS-alpha-2
    • GCYA2_HUMAN
    • Guanylate cyclase soluble subunit alpha-2
    • GUC1A2
    • GUCSA2
    • GUCY1A2
    see all
  • Function

    Has guanylyl cyclase on binding to the beta-1 subunit.
    Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits.
  • Tissue specificity

    Isoform 1 is expressed in fetal brain, liver, colon, endothelium and testis. Isoform 2 is expressed only in liver, colon and endothelium.
  • Sequence similarities

    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab158608 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up