Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQRQPFPR DVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREV IAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEG SPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGD IVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKN DHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNP GQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYG PSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSL QHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLA IDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGAS DKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNL PIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAG
    • Molecular weight

      64 kDa including tags
    • Amino acids

      139 to 693
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134881 was refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains Nacl,EDTA,KCl,arginine,DTT and Glycerol

General Info

  • Alternative names

    • CAD13_HUMAN
    • Cadherin-13
    • CDH13
    • CDHH
    • H-cadherin
    • Heart cadherin
    • P105
    • T cad
    • T Cadherin
    • T-cad
    • T-cadherin
    • Truncated cadherin
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.
  • Tissue specificity

    Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Developmental stage

    Expressed at higher levels in adult brain than in developing brain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab134881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up