Description

  • Product name

    Recombinant Human H-FABP protein (His tag)
    See all H-FABP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDIL TLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDG QETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 133
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab219666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, PBS

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 422 protein
    • Cardiac FABP
    • Cardiac Fatty Acid Binding Protein
    • FABP 11
    • FABP 3
    • FABP11
    • FABP3
    • FABPH_HUMAN
    • Fatty acid binding protein 11
    • Fatty acid binding protein 3
    • Fatty acid binding protein 3 muscle
    • Fatty acid binding protein 3 muscle and heart
    • Fatty acid binding protein 3 muscle and heart mammary derived growth inhibitor
    • Fatty acid binding protein 3, muscle
    • Fatty acid binding protein 3, muscle and heart (mammary derived growth inhibitor)
    • Fatty acid binding protein heart
    • Fatty acid binding protein, heart
    • Fatty acid binding protein, muscle and heart
    • Fatty acid binding protein, skeletal muscle
    • Fatty acid-binding protein
    • Fatty acid-binding protein 3
    • H FABP
    • H-FABP
    • heart
    • Heart type fatty acid binding protein
    • Heart-type fatty acid-binding protein
    • M FABP
    • M-FABP
    • Mammary derived growth inhibitor
    • Mammary-derived growth inhibitor
    • MDGI
    • Muscle fatty acid binding protein
    • Muscle fatty acid-binding protein
    • Mylein protein P2 homolog
    • O FABP
    • OTTHUMP00000003898
    • P2 adopocyte protein
    see all
  • Function

    FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab219666 on SDS-PAGE under reducing (R) conditions.

    The gel was stained overnight with Coomassie Blue.

    The purity of the protein is greater than 95%.

     The protein migrates as 16 kDa under reducing (R) conditions.

References

ab219666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up