Description

  • Product name

    Recombinant Human H2BFWT protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDS FATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKR
    • Amino acids

      31 to 130
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • H2B histone family member W testis-specific
    • H2BFWT
    • H2BWT_HUMAN
    • Histone H2B type W-T
  • Function

    Atypical histone H2B. Nucleosomes containing it are structurally and dynamically indistinguishable from those containing conventional H2B. However, unlike conventional H2B, does not recruit chromosome condensation factors and does not participate in the assembly of mitotic chromosomes. May be important for telomere function.
  • Tissue specificity

    Testis-specific. Present in sperm cells (at protein level).
  • Sequence similarities

    Belongs to the histone H2B family.
  • Cellular localization

    Nucleus membrane. Chromosome.
  • Information by UniProt

Images

  • ab165714 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up