Overview

  • Product name
    Recombinant Human H6PD protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYS PVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLLESLAHKAPRL
    • Amino acids
      401 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6 phosphogluconolactonase
    • 6-phosphogluconolactonase
    • 6PGL
    • CORTRD1
    • G6PD, H form
    • G6PDH
    • G6PE_HUMAN
    • GDH
    • GDH/6PGL endoplasmic bifunctional protein
    • Glucose 1 dehydrogenase
    • Glucose 6 phosphate dehydrogenase, salivary
    • Glucose dehydrogenase
    • Glucose dehyrogenase
    • Gpd1
    • H6pd
    • Hexose 6 phosphate dehydrogenase
    • Hexose 6 phosphate dehydrogenase (glucose 1 dehydrogenase)
    • Hexose-6-phosphate dehydrogenase
    see all
  • Function
    Oxidizes glucose-6-phosphate and glucose, as well as other hexose-6-phosphates.
  • Tissue specificity
    Present in most tissues examined, strongest in liver.
  • Involvement in disease
    Defects in H6PD are a cause of cortisone reductase deficiency (CRD) [MIM:604931]. In CRD, activation of cortisone to cortisol does not occur, resulting in adrenocorticotropin-mediated androgen excess and a phenotype resembling polycystic ovary syndrome (PCOS).
  • Sequence similarities
    In the N-terminal section; belongs to the glucose-6-phosphate dehydrogenase family.
    In the C-terminal section; belongs to the glucosamine/galactosamine-6-phosphate isomerase family. 6-phosphogluconolactonase subfamily.
  • Cellular localization
    Endoplasmic reticulum lumen. Microsomes, endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab160548 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up