Recombinant Human HABP4 protein (ab161479)

Overview

  • Product name
    Recombinant Human HABP4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQ QQLQRKRRDEAAAAAGAGPRGGRSPAGASGHRAGAGGRRESQKERKSLPA PVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLERAERRSYRE YRPYETERQADFTAEKFPDEKVPELEVEEETQVQEMTLDEWKNLQEQTRP KPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPANDITS QLEINFGNLPRPGRGARGGTRGGRGRIRRAENYGPRAEVVMQDVAPNPDD PEDFPALS
    • Amino acids
      1 to 308
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HABP4
    • HABP4_HUMAN
    • IHABP-4
    • IHABP4
    • Intracellular hyaluronan-binding protein 4
    • Ki-1/57 intracellular antigen
    see all
  • Function
    May be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription.
  • Tissue specificity
    Highly expressed in brain, heart, and kidney, and moderately expressed in skeletal muscle. Also expressed in a variety of tumor cell lines and in activated but not resting leukocytes.
  • Post-translational
    modifications
    Phosphorylated by phorbol 12-myristate 13-acetate (PMA)-activated PKC isoforms at Thr-354 and Thr-375.
  • Cellular localization
    Cytoplasm. Nucleus. Transported into the nuclear compartment in activated leukocytes.
  • Information by UniProt

Images

  • ab161479 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up