Description

  • Product name

    Recombinant Human HADHA protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVA VVRINSPNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIA GADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAAINGSCLGGGL EVAISCQYRIATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDM MLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAITFAKG LADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPA PLKIIDVVKTGIEQGSDAGYLCESQKFGELVMTKESKALMGLYHGQVLCK KNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRG QQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFE DLSLKHRVLKEVEAVIPDHCIFASNTSALPISEIAAVSKRPEKVIGMHYF SPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRC LAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA EDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNS DMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEG DIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLL ADHANSPNKKFYQ
    • Amino acids

      1 to 763
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3 ketoacyl Coenzyme A (CoA) thiolase alpha subunit
    • 3 oxoacyl CoA thiolase
    • 78 kDa gastrin binding protein
    • 78 kDa gastrin-binding protein
    • ECHA
    • ECHA_HUMAN
    • GBP
    • HADH
    • HADHA
    • Hydroxyacyl Coenzyme A dehydrogenase/3 ketoacyl Coenzyme A thiolase/enoyl Coenzyme A hydratase (trifunctional protein) alpha subunit
    • LCEH
    • LCHAD
    • Long chain 3-hydroxyacyl-CoA dehydrogenase
    • Mitochondrial long chain 2 enoyl Coenzyme A (CoA) hydratase alpha subunit
    • Mitochondrial long chain L 3 hydroxyacyl Coenzyme A dehydrogenase alpha subunit
    • Mitochondrial trifunctional enzyme alpha subunit
    • Mitochondrial trifunctional protein alpha subunit
    • MTPA
    • Thiolase/enoyl Coenzyme A hydratase (trifunctional protein) alpha subunit
    • TP ALPHA
    • TP-alpha
    • Trifunctional enzyme subunit alpha mitochondrial precursor
    see all
  • Function

    Bifunctional subunit.
  • Pathway

    Lipid metabolism; fatty acid beta-oxidation.
  • Involvement in disease

    Defects in HADHA are a cause of trifunctional protein deficiency (TFP deficiency) [MIM:609015]. The clinical manifestations are very variable and include hypoglycemia, cardiomyopathy and sudden death. Phenotypes with mainly hepatic and neuromyopathic involvement can also be distinguished. Biochemically, TFP deficiency is defined by the loss of all enzyme activities of the TFP complex.
    Defects in HADHA are the cause of long-chain 3-hydroxyl-CoA dehydrogenase deficiency (LCHAD deficiency) [MIM:609016]. The clinical features are very similar to TFP deficiency. Biochemically, LCHAD deficiency is characterized by reduced long-chain 3-hydroxyl-CoA dehydrogenase activity, while the other enzyme activities of the TFP complex are normal or only slightly reduced.
    Defects in HADHA are a cause of maternal acute fatty liver of pregnancy (AFLP) [MIM:609016]. AFLP is a severe maternal illness occurring during pregnancies with affected fetuses. This disease is associated with LCHAD deficiency and characterized by sudden unexplained infant death or hypoglycemia and abnormal liver enzymes (Reye-like syndrome).
  • Sequence similarities

    In the N-terminal section; belongs to the enoyl-CoA hydratase/isomerase family.
    In the central section; belongs to the 3-hydroxyacyl-CoA dehydrogenase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab158631 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up