Description

  • Product name

    Recombinant Human HAND1 protein (denatured)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNLVGSYAHHHHHHHPHPAHPMLHEPF LFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDAR PGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPAD TKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKR KRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 215
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • autonomic nervous system and neural crest derivatives-expressed protein 1
    • Basic helix loop helix transcription factor HAND1
    • bHLHa27
    • Class A basic helix-loop-helix protein 27
    • eHAND
    • Extraembryonic tissues
    • Extraembryonic tissues heart autonomic nervous system and neural crest derivatives expressed protein 1
    • HAND 1
    • HAND1
    • HAND1_HUMAN
    • heart
    • Heart and neural crest derivatives expressed 1
    • Heart and neural crest derivatives expressed protein 1
    • Heart- and neural crest derivatives-expressed protein 1
    • Hxt
    • Thing 1
    • Thing1
    see all
  • Function

    Transcription factor that plays an essential role in both trophoblast-giant cells differentiation and in cardiac morphogenesis. In the adult, could be required for ongoing expression of cardiac-specific genes. Binds the DNA sequence 5'-NRTCTG-3' (non-canonical E-box).
  • Tissue specificity

    Heart.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications

    Phosphorylation by PLK4 disrupts the interaction with MDFIC and leads to tranlocation into the nucleoplasm, allowing dimerization and transcription factor activity.
  • Cellular localization

    Nucleus > nucleoplasm. Nucleus > nucleolus. Interaction with MDFIC sequesters it into the nucleolus, preventing the transcription factor activity. Phosphorylation by PLK4 disrupts the interaction with MDFIC and releases it from the nucleolus, leading to transcription factor activity.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134618.

References

ab134618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up