Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKE LNEILKSTVSSNDKKTKGRTGWPQHVWALELK
    • Amino acids

      135 to 216
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI225906
    • AI661148
    • autonomic nervous system and neural crest derivatives-expressed protein 2
    • Basic helix loop helix transcription factor HAND2
    • bHLHa26
    • Class A basic helix-loop-helix protein 26
    • Deciduum
    • Deciduum heart autonomic nervous system and neural crest derivatives expressed protein 2
    • dHAND
    • DHAND 2
    • DHAND2
    • Ehand 2
    • Ehand2
    • FLJ16260
    • HAND 2
    • Hand2
    • HAND2_HUMAN
    • heart
    • Heart and neural crest derivatives expressed 2
    • Heart and neural crest derivatives expressed protein 2
    • heart and neural crest derivatives expressed transcript 2
    • Heart- and neural crest derivatives-expressed protein 2
    • Hed
    • Highly similar to dHAND M musculus
    • MGC125303
    • MGC125304
    • Th 2
    • Th2
    • Thing 2
    • Thing2
    see all
  • Function

    Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'.
  • Tissue specificity

    Heart.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stage

    Expressed in the fetal heart.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab152992 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up