Description

  • Product name

    Recombinant human HAO1/GOX protein (Active)
    See all HAO1/GOX proteins and peptides
  • Biological activity

    Specific activity is > 3,000 pmol/min/µg, and defined as the amount of enzyme that oxidize glyoxylate at pH 8.0 at 25°C.

  • Purity

    > 95 % SDS-PAGE.
    Purified using conventional chromatography.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMLPRLICINDYEQH AKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLST SVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSS IEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYL GNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAID PSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQ LDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVG RPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRKNP LAVSKI
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1 to 370
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_060015.

Specifications

Our Abpromise guarantee covers the use of ab241318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 2.9% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • (S) 2 hydroxy acid oxidase
    • Glycolate oxidase
    • GOX
    • GOX1
    • HAO1
    • HAOX1
    • HAOX1_HUMAN
    • Hydroxyacid oxidase 1
    • MGC142225
    • MGC142227
    • OTTHUMP00000030231
    see all
  • Function

    Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate.
  • Tissue specificity

    Liver.
  • Pathway

    Organic acid metabolism; glycolate degradation; 3-phospho-D-glycerate from glycolate: step 1/4.
  • Sequence similarities

    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization

    Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab241318.

References

ab241318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up