Description

  • Product name

    Recombinant Human HAO2 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRY LRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAGI CYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQLIQRVESLGFK ALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPIST SLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQL DEVLASIDALTEVVAAVKGKIEVYLDGGVRTGNDVLKALALGAKCIFLGR PILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSRL
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      2 to 351
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • (S)-2-hydroxy-acid oxidase
    • (S)-2-hydroxy-acid oxidase, peroxisomal
    • 2 hydroxy acid oxidase peroxisomal
    • Cell growth-inhibiting gene 16 protein
    • GIG16
    • Glycolate oxidase
    • HAO 2
    • Hao2
    • HAOX2
    • HAOX2_HUMAN
    • Hydroxyacid oxidase 2
    • Hydroxyacid oxidase 2 (long chain)
    • Long chain alpha hydroxy acid oxidase
    • Long chain alpha-hydroxy acid oxidase
    • Long chain L 2 hydroxy acid oxidase
    • Long-chain L-2-hydroxy acid oxidase
    • peroxisomal
    see all
  • Function

    Catalyzes the oxidation of L-alpha-hydroxy acids as well as, more slowly, that of L-alpha-amino acids.
  • Tissue specificity

    Liver and kidney.
  • Sequence similarities

    Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family.
    Contains 1 FMN hydroxy acid dehydrogenase domain.
  • Cellular localization

    Peroxisome.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab239568.

References

ab239568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up