Description

  • Product name

    Recombinant Human HAPLN1 protein (denatured)
    See all HAPLN1 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSDHLSDNYTLDHDRAIHIQAENGPHLLV EAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEV DVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVI EGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFD QLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWD KDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQI FAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKH KLYGVYCFRAYN
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      16 to 354
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein; NP_001875.
  • Description

    Recombinant Human HAPLN1 protein

Specifications

Our Abpromise guarantee covers the use of ab180280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • Cartilage link protein
    • cartilage linking protein 1
    • Cartilage-link protein
    • Cartilage-linking protein 1
    • CLP
    • CRTL1
    • Crtl1l
    • HAPLN1
    • HPLN1_HUMAN
    • Hyaluronan and proteoglycan link protein 1
    • Hyaluronan and proteoglycan link protein 1 precursor
    • LP
    • Proteoglycan link protein
    see all
  • Function

    Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
  • Tissue specificity

    Widely expressed. Weakly expressed in the brain.
  • Sequence similarities

    Belongs to the HAPLN family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180280 (3μg).

References

ab180280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up