Description

  • Product name

    Recombinant Human Haptoglobin protein
    See all Haptoglobin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purity is greater than 90.0% as determined by RP-HPLC and SDS-PAGE.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINE QWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQ VDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTD HLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMS KYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTS IQDWVQKTIAE
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      145 to 405

Specifications

Our Abpromise guarantee covers the use of ab73587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Constituents: PBS, 0.1% SDS, 0.0154% DTT

  • Reconstitution
    Reconstitute in sterile 18MOhm/cm water at not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

General Info

  • Alternative names

    • Binding peptide
    • BP
    • Haptoglobin alpha chain
    • Haptoglobin alpha(1S) beta
    • Haptoglobin alpha(2FS) beta
    • Haptoglobin beta chain
    • Haptoglobin, alpha polypeptide
    • Haptoglobin, beta polypeptide
    • HP
    • HP2 ALPHA2
    • HP2ALPHA2
    • HPA1S
    • HPT
    • HPT_HUMAN
    • MGC111141
    • Zonulin
    see all
  • Function

    As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
    Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Anhaptoglobinemia
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab73587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for your recent telephone enquiry.
I can confirm the following information regarding our haptoglobin proteins:

ab77872 Haptoglobin protein
This protein is purified from a mix of donors and so contains all 3 forms.

ab90924 Haptoglobin protein (Human)
Again, this is mixed

ab63120 ab83165 and ab83167 beta haptoglobin proteins:
Haptoglobin is a tetramer of two alpha and two beta chains, connected by disulfide bridges. The chains originate from a common precursor protein, which is proteolytically cleaved during protein synthesis. Our recombinant Haptoglobin β-chain comprises a 245 amino acid fragment (162-406) corresponding to the mature haptoglobin β-chain and is expressed in E. coli with an amino-terminal hexahistidine tag.

ab73587 Haptoglobin protein (His tag)

I have the sequence of the protein for you. However, I am sorry I have not yet confirmed which form of the protein this is. As soon as we have more information, I will get back to you.

VD SGNDVTDIAD DGCPKPPEIA HGYVEHSVRY QCKNYYKLRTE GDGVYTLND KKQWINKAVG DKLPECEADD GCPKPPEIAH GYVEHSVRYQ CKNYYKLRTE GDGVYTLNNE KQWINKAVGD KLPECEAVCG KPKNPANPVQ RILGGHLDAK GSFPWQAKMV SHHNLTTGAT LINEQWLLTT AKNLFLNHSE NATAKDIAPT LTLYVGKKQL VEIEKVVLHPNYSQVDIGLI KLKQKVSVNE RVMPICLPSK DYAEVGRVGY VSGWGRNANF KFTDHLKYVMLPVADQDQCI RHYEGSTVPE KKTPKSPVGV QPILNEHTFC AGMSKYQEDT CYGDAGSAFA VHDLEEDTWY ATGILSFDKS CAVAEYGVYV KVTSIQDWVQ KTIAEN

I can also confirm that regrettably these have not been tested in functional studies.

I am sorry we do not have the range of specific proteins you require on this occasion. If you have any further questions, please do not hesitate to contact us. Good luck with your research.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up