Recombinant Human Haptoglobin protein (Tagged-His Tag) (ab196135)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: HPLC, SDS-PAGE
Description
-
Product name
Recombinant Human Haptoglobin protein (Tagged-His Tag)
See all Haptoglobin proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity of ab196135 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTL NDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLR TEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLN HSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVS VNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQD QCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGS AFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENV DHHHHHH -
Predicted molecular weight
44 kDa including tags -
Molecular weight information
Predicted MW: 15.9 and 28.3 kDa Apparent MW: 16 and 40-75 kDa (under reducing conditions) -
Amino acids
19 to 406 -
Tags
His tag C-Terminus -
Additional sequence information
Amino acid sequence from 19-160 and 162-406. Amino acid 161 is missing from this product. 6-His tag is on the beta chain
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab196135 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 99% PBS, 0.02% DTT
Supplied as a 0.2 µm filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- Binding peptide
- BP
- Haptoglobin alpha chain
see all -
Function
As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens. -
Tissue specificity
Expressed by the liver and secreted in plasma. -
Involvement in disease
Anhaptoglobinemia -
Sequence similarities
Belongs to the peptidase S1 family.
Contains 1 peptidase S1 domain.
Contains 2 Sushi (CCP/SCR) domains. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab196135 has not yet been referenced specifically in any publications.