Overview

  • Product name
    Recombinant Human HARS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQE KPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELK ETLTEKYGE
    • Amino acids
      2 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4631412B19Rik
    • AI593507
    • HARS 2
    • HARS related
    • Hars2
    • Harsl
    • HARSR
    • HisRS
    • Histidine translase
    • Histidine tRNA ligase
    • Histidine tRNA ligase homolog
    • Histidine tRNA ligase like
    • Histidine--tRNA ligase
    • Histidine--tRNA ligase-like
    • Histidyl tRNA synthetase 2 mitochondrial
    • Histidyl tRNA synthetase like
    • HO3
    • mitochondrial
    • PRLTS2
    • Probable histidyl tRNA synthetase mitochondrial
    • Probable histidyl-tRNA synthetase
    • SYHM_HUMAN
    see all
  • Tissue specificity
    A high level expression is seen in the heart, kidney and skeletal muscle while a lower level expression is seen in the brain and liver.
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab161646 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up