Description

  • Product name

    Recombinant Human HAUSP / USP7 protein (Tagged)
    See all HAUSP / USP7 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRV FYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKG TCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFES FVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDP QTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGG HYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNA YMLVYIRE
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      214 to 521
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab239558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Deubiquitinating enzyme 7
    • HAUSP
    • Herpes virus associated ubiquitin specific protease
    • Herpesvirus-associated ubiquitin-specific protease
    • TEF 1
    • tef-1
    • TEF1
    • Ubiquitin carboxyl terminal hydrolase 7
    • Ubiquitin carboxyl-terminal hydrolase 7
    • Ubiquitin specific peptidase 7
    • Ubiquitin specific peptidase 7 (herpes virus associated)
    • Ubiquitin specific peptidase 7 herpes virus associated
    • Ubiquitin specific processing protease 7
    • Ubiquitin specific protease 7
    • Ubiquitin specific protease 7 (herpes virus associated)
    • Ubiquitin specific protease 7 herpes virus associated
    • Ubiquitin thioesterase 7
    • Ubiquitin thiolesterase 7
    • Ubiquitin-specific-processing protease 7
    • UBP 7
    • UBP-7
    • UBP7
    • UBP7_HUMAN
    • USP 7
    • usp-7
    • Usp7
    • VMW110-ASSOCIATED PROTEIN, 135-KD
    see all
  • Function

    Hydrolase that deubiquitinates target proteins such as FOXO4, p53/TP53, MDM2, ERCC6, DNMT1, UHRF1, PTEN and DAXX (PubMed:11923872, PubMed:15053880, PubMed:16964248, PubMed:18716620, PubMed:25283148). Together with DAXX, prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards p53/TP53, thereby promoting p53/TP53 ubiquitination and proteasomal degradation. Deubiquitinates p53/TP53, preventing degradation of p53/TP53, and enhances p53/TP53-dependent transcription regulation, cell growth repression and apoptosis (PubMed:25283148). Deubiquitinates p53/TP53 and MDM2 and strongly stabilizes p53/TP53 even in the presence of excess MDM2, and also induces p53/TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on p53/TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. Involved in cell proliferation during early embryonic development. Involved in transcription-coupled nucleotide excision repair (TC-NER) in response to UV damage: recruited to DNA damage sites following interaction with KIAA1530/UVSSA and promotes deubiquitination of ERCC6, preventing UV-induced degradation of ERCC6. Contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection. Involved in maintenance of DNA methylation via its interaction with UHRF1 and DNMT1: acts by mediating deubiquitination of UHRF1 and DNMT1, preventing their degradation and promoting DNA methylation by DNMT1 (PubMed:21745816). Exhibits a preference towards 'Lys-48'-linked ubiquitin chains. Increases regulatory T-cells (Treg) suppressive capacity by deubiquitinating and stabilizing the transcription factor FOXP3 which is crucial for Treg cell function (PubMed:23973222).
  • Tissue specificity

    Widely expressed. Overexpressed in prostate cancer.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 1 MATH domain.
    Contains 1 USP domain.
  • Domain

    The C-terminus plays a role in its oligomerization.
  • Post-translational
    modifications

    Isoform 1: Phosphorylated. Isoform 1 is phosphorylated at positions Ser-18 and Ser-963. Isoform 2: Not phosphorylated.
    Isoform 1: Polyneddylated. Isoform 2: Not Polyneddylated.
    Isoform 1 and isoform 2: Not sumoylated.
    Isoform 1 and isoform 2: Polyubiquitinated by herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110; leading to its subsequent proteasomal degradation. Isoform 1: Ubiquitinated at Lys-869.
  • Cellular localization

    Nucleus. Cytoplasm. Nucleus, PML body. Present in a minority of ND10 nuclear bodies. Association with ICP0/VMW110 at early times of infection leads to an increased proportion of USP7-containing ND10. Colocalizes with ATXN1 in the nucleus. Colocalized with DAXX in speckled structures. Colocalized with PML and PTEN in promyelocytic leukemia protein (PML) nuclear bodies.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239558.

References

ab239558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up