Description

  • Product name

    Recombinant Human HBEGF/DTR protein
    See all HBEGF/DTR proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab167830 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSDLQEADLDLLRVTLSSKPQALATPNKE EHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYH GERCHGLSL
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      63 to 148
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as HB EGF

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • Diphtheria toxin receptor
    • diphtheria toxin receptor (heparin-binding EGF-like growth factor)
    • diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor)
    • DT R
    • DT-R
    • DTR
    • DTS
    • DTSF
    • HB-EGF
    • HBEGF
    • HBEGF_HUMAN
    • HEGFL
    • Heparin binding EGF like growth factor
    • Heparin binding epidermal growth factor
    • Heparin binding epidermal growth factor like growth factor
    • Heparin-binding EGF-like growth factor
    • Proheparin binding EGF like growth factor
    see all
  • Function

    May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts and smooth muscle but not endothelial cells. It is able to bind EGF receptors with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Post-translational
    modifications

    Several N-termini have been identified by direct sequencing. The forms with N-termini 63, 73 and 74 have been tested and found to be biologically active.
    O-linked glycan attachment sites were determined by Edman degradation, O-glycanase digest suggests mucin-type glycosylation (done in HB-EGF purified from histiocytic lymphoma cell line U-937).
  • Cellular localization

    Cell membrane and Secreted > extracellular space. Mature HB-EGF is released into the extracellular space and probably binds to a receptor.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167830 (3µg).

References

This product has been referenced in:

  • Liu J  et al. CD9 regulates keratinocyte migration by negatively modulating the sheddase activity of ADAM17. Int J Biol Sci 15:493-506 (2019). Read more (PubMed: 30745837) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up